General Information

  • ID:  hor003178
  • Uniprot ID:  A0A3R7QE37
  • Protein name:  RYamide
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  SGFYANRY
  • Length:  8(95-102)
  • Propeptide:  MSVVQPESKKQTQRSHTHRLQRPLDAPRLAFDAHSPALAPLPQPLPNVAPPKMSRFLCHMTLLLLAAVALSAAQGFYSQRYGKRGDSNREITVRSGFYANRYGRSPPHDLPEIKVRSSRFIGGSRYGKRSGPADVTPIMTSEADEAEMPATFLVGESVVCLLIDVPDIYRCIRKSVSEESTN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3R7QE37-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003178_AF2.pdbhor003178_ESM.pdb

Physical Information

Mass: 110207 Formula: C45H60N12O13
Absent amino acids: CDEHIKLMPQTVW Common amino acids: Y
pI: 9.17 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -90 Boman Index: -1951
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 12.5
Instability Index: 6967.5 Extinction Coefficient cystines: 2980
Absorbance 280nm: 425.71

Literature

  • PubMed ID:  19852991
  • Title:  Combining in Silico Transcriptome Mining and Biological Mass Spectrometry for Neuropeptide Discovery in the Pacific White Shrimp Litopenaeus Vannamei